Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for xkcd 11. xkcd 4 pts. 8,524
  2. Avatar for freefolder 12. freefolder 2 pts. 8,354
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 7,931
  4. Avatar for Russian team 14. Russian team 1 pt. 7,910
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 7,732
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,647
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,600
  8. Avatar for SciOne2017 19. SciOne2017 1 pt. 7,586
  9. Avatar for Deleted group 20. Deleted group pts. 7,200

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 8,955
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 8,953
  3. Avatar for reefyrob 3. reefyrob Lv 1 73 pts. 8,952
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 62 pts. 8,947
  5. Avatar for Galaxie 5. Galaxie Lv 1 52 pts. 8,947
  6. Avatar for gmn 6. gmn Lv 1 43 pts. 8,945
  7. Avatar for phi16 7. phi16 Lv 1 36 pts. 8,938
  8. Avatar for lamoille 8. lamoille Lv 1 30 pts. 8,935
  9. Avatar for Deleted player 9. Deleted player pts. 8,935
  10. Avatar for jermainiac 10. jermainiac Lv 1 20 pts. 8,935

Comments