Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for xkcd 11. xkcd 4 pts. 8,524
  2. Avatar for freefolder 12. freefolder 2 pts. 8,354
  3. Avatar for Natural Abilities 13. Natural Abilities 2 pts. 7,931
  4. Avatar for Russian team 14. Russian team 1 pt. 7,910
  5. Avatar for Eὕρηκα! Heureka! 15. Eὕρηκα! Heureka! 1 pt. 7,732
  6. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,647
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 7,600
  8. Avatar for SciOne2017 19. SciOne2017 1 pt. 7,586
  9. Avatar for Deleted group 20. Deleted group pts. 7,200

  1. Avatar for a.smith25 151. a.smith25 Lv 1 1 pt. 7,597
  2. Avatar for Dantoto 152. Dantoto Lv 1 1 pt. 7,594
  3. Avatar for 64SciOne 153. 64SciOne Lv 1 1 pt. 7,586
  4. Avatar for Ciccillo 154. Ciccillo Lv 1 1 pt. 7,563
  5. Avatar for iceslayer 155. iceslayer Lv 1 1 pt. 7,561
  6. Avatar for 3966437 156. 3966437 Lv 1 1 pt. 7,560
  7. Avatar for heyubob 157. heyubob Lv 1 1 pt. 7,531
  8. Avatar for noforgiven 158. noforgiven Lv 1 1 pt. 7,425
  9. Avatar for chipmunk101 159. chipmunk101 Lv 1 1 pt. 7,393
  10. Avatar for Mrma94 160. Mrma94 Lv 1 1 pt. 7,356

Comments