Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 8,955
  2. Avatar for LociOiling 2. LociOiling Lv 1 86 pts. 8,953
  3. Avatar for reefyrob 3. reefyrob Lv 1 73 pts. 8,952
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 62 pts. 8,947
  5. Avatar for Galaxie 5. Galaxie Lv 1 52 pts. 8,947
  6. Avatar for gmn 6. gmn Lv 1 43 pts. 8,945
  7. Avatar for phi16 7. phi16 Lv 1 36 pts. 8,938
  8. Avatar for lamoille 8. lamoille Lv 1 30 pts. 8,935
  9. Avatar for Deleted player 9. Deleted player pts. 8,935
  10. Avatar for jermainiac 10. jermainiac Lv 1 20 pts. 8,935

Comments