Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups

  1. Avatar for CP Bio 2016 21. CP Bio 2016 1 pt. 5,275
  1. Avatar for Simek 61. Simek Lv 1 11 pts. 8,607
  2. Avatar for eusair 62. eusair Lv 1 11 pts. 8,605
  3. Avatar for cobaltteal 63. cobaltteal Lv 1 10 pts. 8,603
  4. Avatar for JayD7217 64. JayD7217 Lv 1 10 pts. 8,599
  5. Avatar for jobo0502 65. jobo0502 Lv 1 10 pts. 8,580
  6. Avatar for gurch 66. gurch Lv 1 9 pts. 8,578
  7. Avatar for phi16 67. phi16 Lv 1 9 pts. 8,562
  8. Avatar for Merf 68. Merf Lv 1 8 pts. 8,556
  9. Avatar for diamonddays 69. diamonddays Lv 1 8 pts. 8,549
  10. Avatar for isaksson 70. isaksson Lv 1 8 pts. 8,548

Comments