Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 9,351
  2. Avatar for xkcd 12. xkcd 2 pts. 9,105
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,105
  4. Avatar for SciOne2017 14. SciOne2017 1 pt. 8,645
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,316
  6. Avatar for freefolder 16. freefolder 1 pt. 8,021
  7. Avatar for Deleted group 17. Deleted group pts. 8,020
  8. Avatar for JCBio162 18. JCBio162 1 pt. 7,495
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,438
  10. Avatar for BioChem22017 20. BioChem22017 1 pt. 7,395
  1. Avatar for Bruno Kestemont 11. Bruno Kestemont Lv 1 77 pts. 10,100
  2. Avatar for Keresto 12. Keresto Lv 1 75 pts. 10,100
  3. Avatar for kabubi 13. kabubi Lv 1 73 pts. 10,095
  4. Avatar for pauldunn 14. pauldunn Lv 1 71 pts. 10,090
  5. Avatar for ZeroLeak7 15. ZeroLeak7 Lv 1 70 pts. 10,086
  6. Avatar for gmn 16. gmn Lv 1 68 pts. 10,074
  7. Avatar for actiasluna 17. actiasluna Lv 1 66 pts. 10,067
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 64 pts. 10,065
  9. Avatar for frood66 19. frood66 Lv 1 62 pts. 10,064
  10. Avatar for LociOiling 20. LociOiling Lv 1 61 pts. 10,064

Comments