Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary

Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 9,351
  2. Avatar for xkcd 12. xkcd 2 pts. 9,105
  3. Avatar for Kotocycle 13. Kotocycle 2 pts. 9,105
  4. Avatar for SciOne2017 14. SciOne2017 1 pt. 8,645
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 8,316
  6. Avatar for freefolder 16. freefolder 1 pt. 8,021
  7. Avatar for Deleted group 17. Deleted group pts. 8,020
  8. Avatar for JCBio162 18. JCBio162 1 pt. 7,495
  9. Avatar for DSN @ Home 19. DSN @ Home 1 pt. 7,438
  10. Avatar for BioChem22017 20. BioChem22017 1 pt. 7,395
  1. Avatar for PauloRosseto 191. PauloRosseto Lv 1 1 pt. 5,303
  2. Avatar for Brainiac_2017 192. Brainiac_2017 Lv 1 1 pt. 5,303
  3. Avatar for CobaltTheLioness 193. CobaltTheLioness Lv 1 1 pt. 5,294
  4. Avatar for TomTaylor 194. TomTaylor Lv 1 1 pt. 5,294
  5. Avatar for Hollinas 195. Hollinas Lv 1 1 pt. 5,294
  6. Avatar for apbiology101 196. apbiology101 Lv 1 1 pt. 5,294
  7. Avatar for blu 197. blu Lv 1 1 pt. 5,239

Comments