Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Design Design Design Design Design Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 10,296
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 98 pts. 10,283
  3. Avatar for bertro 3. bertro Lv 1 96 pts. 10,274
  4. Avatar for mimi 4. mimi Lv 1 93 pts. 10,236
  5. Avatar for gitwut 5. gitwut Lv 1 91 pts. 10,188
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 88 pts. 10,167
  7. Avatar for smilingone 7. smilingone Lv 1 86 pts. 10,154
  8. Avatar for markm457 8. markm457 Lv 1 84 pts. 10,129
  9. Avatar for nicobul 9. nicobul Lv 1 82 pts. 10,117
  10. Avatar for Galaxie 10. Galaxie Lv 1 80 pts. 10,100

Comments