Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 5,659

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,316
  2. Avatar for reefyrob 2. reefyrob Lv 1 86 pts. 10,314
  3. Avatar for LociOiling 3. LociOiling Lv 1 73 pts. 10,298
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 62 pts. 10,288
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 52 pts. 10,244
  6. Avatar for crpainter 6. crpainter Lv 1 43 pts. 10,241
  7. Avatar for mimi 7. mimi Lv 1 36 pts. 10,239
  8. Avatar for gitwut 8. gitwut Lv 1 30 pts. 10,211
  9. Avatar for georg137 9. georg137 Lv 1 24 pts. 10,209
  10. Avatar for Galaxie 10. Galaxie Lv 1 20 pts. 10,152

Comments