Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Beta Folders 100 pts. 10,316
  2. Avatar for Contenders 2. Contenders 78 pts. 10,244
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,152
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 45 pts. 10,117
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 10,106
  6. Avatar for Go Science 6. Go Science 24 pts. 10,100
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,095
  8. Avatar for Deleted group 8. Deleted group pts. 9,690
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,463
  10. Avatar for Natural Abilities 10. Natural Abilities 6 pts. 9,360

  1. Avatar for smilingone
    1. smilingone Lv 1
    100 pts. 10,316
  2. Avatar for reefyrob 2. reefyrob Lv 1 86 pts. 10,314
  3. Avatar for LociOiling 3. LociOiling Lv 1 73 pts. 10,298
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 62 pts. 10,288
  5. Avatar for Bletchley Park 5. Bletchley Park Lv 1 52 pts. 10,244
  6. Avatar for crpainter 6. crpainter Lv 1 43 pts. 10,241
  7. Avatar for mimi 7. mimi Lv 1 36 pts. 10,239
  8. Avatar for gitwut 8. gitwut Lv 1 30 pts. 10,211
  9. Avatar for georg137 9. georg137 Lv 1 24 pts. 10,209
  10. Avatar for Galaxie 10. Galaxie Lv 1 20 pts. 10,152

Comments