1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Summary

• Created: January 25, 2017
• Expires: February 01, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups

• 1. Beta Folders 100 pts. 10,316
• 2. Contenders 78 pts. 10,244
• 3. Anthropic Dreams 60 pts. 10,152
• 4. L'Alliance Francophone 45 pts. 10,117
• 5. Gargleblasters 33 pts. 10,106
• 6. Go Science 24 pts. 10,100
• 7. Void Crushers 17 pts. 10,095
• 8. Deleted group pts. 9,690
• 9. Italiani Al Lavoro 8 pts. 9,463
• 10. Natural Abilities 6 pts. 9,360

Top evolvers

• 21. Bruno Kestemont 1 pt. 10,073
• 22. jermainiac 1 pt. 10,070
• 23. Norrjane 1 pt. 10,020
• 24. SaraL 1 pt. 10,013
• 25. Paulo Roque 1 pt. 9,986
• 26. Anfinsen_slept_here 1 pt. 9,982
• 27. phi16 1 pt. 9,975
• 28. jfryk 1 pt. 9,974
• 29. alcor29 1 pt. 9,968
• 30. alwen 1 pt. 9,795