Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Overall Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Beta Folders 100 pts. 10,316
  2. Avatar for Contenders 2. Contenders 78 pts. 10,244
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,152
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 45 pts. 10,117
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 10,106
  6. Avatar for Go Science 6. Go Science 24 pts. 10,100
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,095
  8. Avatar for Deleted group 8. Deleted group pts. 9,690
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,463
  10. Avatar for Natural Abilities 10. Natural Abilities 6 pts. 9,360

  1. Avatar for PauloRosseto 191. PauloRosseto Lv 1 1 pt. 5,303
  2. Avatar for Brainiac_2017 192. Brainiac_2017 Lv 1 1 pt. 5,303
  3. Avatar for TomTaylor 193. TomTaylor Lv 1 1 pt. 5,294
  4. Avatar for Hollinas 194. Hollinas Lv 1 1 pt. 5,294
  5. Avatar for apbiology101 195. apbiology101 Lv 1 1 pt. 5,294
  6. Avatar for CobaltTheLioness 196. CobaltTheLioness Lv 1 1 pt. 5,294
  7. Avatar for blu 197. blu Lv 1 1 pt. 5,239

Comments