Placeholder image of a protein
Icon representing a puzzle

1333: Revisiting Puzzle 86: Nematode

Closed since about 9 years ago

Intermediate Intermediate Overall Overall Design Design

Summary


Created
January 25, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Beta Folders 100 pts. 10,316
  2. Avatar for Contenders 2. Contenders 78 pts. 10,244
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 60 pts. 10,152
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 45 pts. 10,117
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 10,106
  6. Avatar for Go Science 6. Go Science 24 pts. 10,100
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,095
  8. Avatar for Deleted group 8. Deleted group pts. 9,690
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 9,463
  10. Avatar for Natural Abilities 10. Natural Abilities 6 pts. 9,360

  1. Avatar for fryguy 81. fryguy Lv 1 8 pts. 9,105
  2. Avatar for Ikuso 82. Ikuso Lv 1 7 pts. 9,105
  3. Avatar for johngran 83. johngran Lv 1 7 pts. 9,041
  4. Avatar for altaris 84. altaris Lv 1 7 pts. 9,032
  5. Avatar for eromana 85. eromana Lv 1 7 pts. 9,006
  6. Avatar for sgandlur 86. sgandlur Lv 1 6 pts. 8,968
  7. Avatar for SKSbell 87. SKSbell Lv 1 6 pts. 8,966
  8. Avatar for katling 88. katling Lv 1 6 pts. 8,965
  9. Avatar for altejoh 89. altejoh Lv 1 6 pts. 8,938
  10. Avatar for Arne Heessels 90. Arne Heessels Lv 1 5 pts. 8,810

Comments