Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 9,840
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 87 pts. 9,840
  3. Avatar for toshiue 3. toshiue Lv 1 74 pts. 9,839
  4. Avatar for Hollinas 4. Hollinas Lv 1 64 pts. 9,839
  5. Avatar for Galaxie 5. Galaxie Lv 1 54 pts. 9,837
  6. Avatar for JayD7217 6. JayD7217 Lv 1 46 pts. 9,833
  7. Avatar for phi16 7. phi16 Lv 1 38 pts. 9,832
  8. Avatar for pauldunn 8. pauldunn Lv 1 32 pts. 9,831
  9. Avatar for LociOiling 9. LociOiling Lv 1 27 pts. 9,831
  10. Avatar for jfryk 10. jfryk Lv 1 22 pts. 9,830

Comments