Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 9,841
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 98 pts. 9,841
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 95 pts. 9,837
  4. Avatar for Galaxie 4. Galaxie Lv 1 93 pts. 9,834
  5. Avatar for Scopper 5. Scopper Lv 1 91 pts. 9,833
  6. Avatar for bertro 6. bertro Lv 1 88 pts. 9,825
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 86 pts. 9,814
  8. Avatar for tokens 8. tokens Lv 1 84 pts. 9,808
  9. Avatar for caglar 9. caglar Lv 1 81 pts. 9,797
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 79 pts. 9,786

Comments