Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for MicElephant 101. MicElephant Lv 1 3 pts. 8,761
  2. Avatar for mitarcher 102. mitarcher Lv 1 3 pts. 8,760
  3. Avatar for JUMELLE54 103. JUMELLE54 Lv 1 3 pts. 8,738
  4. Avatar for ViJay7019 104. ViJay7019 Lv 1 3 pts. 8,738
  5. Avatar for ManVsYard 105. ManVsYard Lv 1 3 pts. 8,734
  6. Avatar for Superphosphate 106. Superphosphate Lv 1 2 pts. 8,727
  7. Avatar for smholst 107. smholst Lv 1 2 pts. 8,724
  8. Avatar for Kiwegapa 108. Kiwegapa Lv 1 2 pts. 8,713
  9. Avatar for johngran 109. johngran Lv 1 2 pts. 8,680
  10. Avatar for Jim Fraser 110. Jim Fraser Lv 1 2 pts. 8,659

Comments