Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for 1210115146 111. 1210115146 Lv 1 2 pts. 8,634
  2. Avatar for JayD7217 112. JayD7217 Lv 1 2 pts. 8,601
  3. Avatar for starkid 113. starkid Lv 1 2 pts. 8,592
  4. Avatar for wosser1 114. wosser1 Lv 1 2 pts. 8,588
  5. Avatar for rinze 115. rinze Lv 1 2 pts. 8,576
  6. Avatar for khendarg 116. khendarg Lv 1 2 pts. 8,531
  7. Avatar for dbuske 117. dbuske Lv 1 2 pts. 8,505
  8. Avatar for navn 118. navn Lv 1 1 pt. 8,496
  9. Avatar for Amphimixus 119. Amphimixus Lv 1 1 pt. 8,473
  10. Avatar for Cerzax 120. Cerzax Lv 1 1 pt. 8,429

Comments