Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for doctaven 141. doctaven Lv 1 1 pt. 7,789
  2. Avatar for boondog 142. boondog Lv 1 1 pt. 7,757
  3. Avatar for gu14016 143. gu14016 Lv 1 1 pt. 7,734
  4. Avatar for demeter900 144. demeter900 Lv 1 1 pt. 7,649
  5. Avatar for samchop 145. samchop Lv 1 1 pt. 7,648
  6. Avatar for gu14015 146. gu14015 Lv 1 1 pt. 7,635
  7. Avatar for 55SciOne 147. 55SciOne Lv 1 1 pt. 7,633
  8. Avatar for Arne Heessels 148. Arne Heessels Lv 1 1 pt. 7,587
  9. Avatar for Luxuskatze 149. Luxuskatze Lv 1 1 pt. 7,569
  10. Avatar for cherry39 150. cherry39 Lv 1 1 pt. 7,552

Comments