Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for fero 151. fero Lv 1 1 pt. 7,518
  2. Avatar for Net4all 152. Net4all Lv 1 1 pt. 7,260
  3. Avatar for jup 153. jup Lv 1 1 pt. 7,230
  4. Avatar for nagistick 154. nagistick Lv 1 1 pt. 7,181
  5. Avatar for DScott 155. DScott Lv 1 1 pt. 7,152
  6. Avatar for racingsnailrider 156. racingsnailrider Lv 1 1 pt. 7,130
  7. Avatar for pandapharmd 157. pandapharmd Lv 1 1 pt. 7,071
  8. Avatar for alaino29 158. alaino29 Lv 1 1 pt. 7,055
  9. Avatar for cjreinholt 159. cjreinholt Lv 1 1 pt. 7,044
  10. Avatar for 64SciOne 160. 64SciOne Lv 1 1 pt. 7,014

Comments