Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0

  1. Avatar for billdozer3000 161. billdozer3000 Lv 1 1 pt. 6,857
  2. Avatar for Gereon Fischer 162. Gereon Fischer Lv 1 1 pt. 6,708
  3. Avatar for Nedran 163. Nedran Lv 1 1 pt. 6,662
  4. Avatar for 01010011111 164. 01010011111 Lv 1 1 pt. 6,641
  5. Avatar for saksoft2 165. saksoft2 Lv 1 1 pt. 6,612
  6. Avatar for grogar7 166. grogar7 Lv 1 1 pt. 6,513
  7. Avatar for xplocast1 167. xplocast1 Lv 1 1 pt. 6,255
  8. Avatar for rezaefar 168. rezaefar Lv 1 1 pt. 6,139
  9. Avatar for 14rdd 169. 14rdd Lv 1 1 pt. 5,885
  10. Avatar for jay kim 170. jay kim Lv 1 1 pt. 5,635

Comments