Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for Vredeman 11. Vredeman Lv 1 77 pts. 9,784
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 75 pts. 9,782
  3. Avatar for eusair 13. eusair Lv 1 73 pts. 9,781
  4. Avatar for Susume 14. Susume Lv 1 71 pts. 9,780
  5. Avatar for jfryk 15. jfryk Lv 1 69 pts. 9,778
  6. Avatar for spvincent 16. spvincent Lv 1 67 pts. 9,773
  7. Avatar for jermainiac 17. jermainiac Lv 1 65 pts. 9,752
  8. Avatar for hansvandenhof 18. hansvandenhof Lv 1 64 pts. 9,722
  9. Avatar for isaksson 19. isaksson Lv 1 62 pts. 9,684
  10. Avatar for guineapig 20. guineapig Lv 1 60 pts. 9,681

Comments