Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for LociOiling 21. LociOiling Lv 1 58 pts. 9,664
  2. Avatar for Blipperman 22. Blipperman Lv 1 57 pts. 9,647
  3. Avatar for manu8170 23. manu8170 Lv 1 55 pts. 9,604
  4. Avatar for reefyrob 24. reefyrob Lv 1 54 pts. 9,600
  5. Avatar for Skippysk8s 25. Skippysk8s Lv 1 52 pts. 9,598
  6. Avatar for pmdpmd 26. pmdpmd Lv 1 50 pts. 9,598
  7. Avatar for Museka 27. Museka Lv 1 49 pts. 9,588
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 48 pts. 9,585
  9. Avatar for dcrwheeler 29. dcrwheeler Lv 1 46 pts. 9,583
  10. Avatar for johnmitch 30. johnmitch Lv 1 45 pts. 9,583

Comments