Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for pauldunn 31. pauldunn Lv 1 43 pts. 9,551
  2. Avatar for jobo0502 32. jobo0502 Lv 1 42 pts. 9,530
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 41 pts. 9,525
  4. Avatar for fryguy 34. fryguy Lv 1 40 pts. 9,522
  5. Avatar for smilingone 35. smilingone Lv 1 38 pts. 9,498
  6. Avatar for Timo van der Laan 36. Timo van der Laan Lv 1 37 pts. 9,484
  7. Avatar for gitwut 37. gitwut Lv 1 36 pts. 9,455
  8. Avatar for Bletchley Park 38. Bletchley Park Lv 1 35 pts. 9,452
  9. Avatar for Reldas 39. Reldas Lv 1 34 pts. 9,451
  10. Avatar for Deleted player 40. Deleted player pts. 9,428

Comments