Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Team China 21. Team China 1 pt. 5,440
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for diamonddays 51. diamonddays Lv 1 23 pts. 9,375
  2. Avatar for Fat Tony 52. Fat Tony Lv 1 22 pts. 9,369
  3. Avatar for gmn 53. gmn Lv 1 21 pts. 9,368
  4. Avatar for alwen 54. alwen Lv 1 21 pts. 9,357
  5. Avatar for nicobul 55. nicobul Lv 1 20 pts. 9,343
  6. Avatar for uihcv 56. uihcv Lv 1 19 pts. 9,336
  7. Avatar for andrewxc 57. andrewxc Lv 1 19 pts. 9,317
  8. Avatar for Vinara 58. Vinara Lv 1 18 pts. 9,289
  9. Avatar for crpainter 59. crpainter Lv 1 17 pts. 9,287
  10. Avatar for Mike Cassidy 60. Mike Cassidy Lv 1 17 pts. 9,286

Comments