Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248
  1. Avatar for smilingone 11. smilingone Lv 1 18 pts. 9,828
  2. Avatar for lamoille 12. lamoille Lv 1 15 pts. 9,827
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 12 pts. 9,826
  4. Avatar for hansvandenhof 14. hansvandenhof Lv 1 9 pts. 9,826
  5. Avatar for tokens 15. tokens Lv 1 8 pts. 9,823
  6. Avatar for gmn 16. gmn Lv 1 6 pts. 9,822
  7. Avatar for ViJay7019 17. ViJay7019 Lv 1 5 pts. 9,821
  8. Avatar for reefyrob 18. reefyrob Lv 1 4 pts. 9,819
  9. Avatar for jermainiac 19. jermainiac Lv 1 3 pts. 9,809
  10. Avatar for Bletchley Park 20. Bletchley Park Lv 1 2 pts. 9,784

Comments