Placeholder image of a protein
Icon representing a puzzle

1335: Unsolved De-novo Freestyle 98

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 31, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEEEWKQILEEIKELVKRLGVKEVRIEKRDGEIHVELRMDGVEIRIEIRDGEVTIEIRNGTEDIKREVEKVLRRIEKIWK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,841
  2. Avatar for Go Science 2. Go Science 80 pts. 9,841
  3. Avatar for Beta Folders 3. Beta Folders 63 pts. 9,831
  4. Avatar for Contenders 4. Contenders 49 pts. 9,784
  5. Avatar for Gargleblasters 5. Gargleblasters 37 pts. 9,688
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 28 pts. 9,610
  7. Avatar for xkcd 7. xkcd 21 pts. 9,522
  8. Avatar for Void Crushers 8. Void Crushers 15 pts. 9,484
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,385
  10. Avatar for Kotocycle 10. Kotocycle 8 pts. 9,248

  1. Avatar for gitwut 21. gitwut Lv 1 2 pts. 9,780
  2. Avatar for mimi 22. mimi Lv 1 1 pt. 9,779
  3. Avatar for georg137 23. georg137 Lv 1 1 pt. 9,766
  4. Avatar for alcor29 24. alcor29 Lv 1 1 pt. 9,746
  5. Avatar for alwen 25. alwen Lv 1 1 pt. 9,740
  6. Avatar for andrewxc 26. andrewxc Lv 1 1 pt. 9,688
  7. Avatar for uihcv 27. uihcv Lv 1 1 pt. 9,678
  8. Avatar for Skippysk8s 28. Skippysk8s Lv 1 1 pt. 9,638
  9. Avatar for actiasluna 29. actiasluna Lv 1 1 pt. 9,628
  10. Avatar for nicobul 30. nicobul Lv 1 1 pt. 9,610

Comments