Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436

  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 78 pts. 9,641
  2. Avatar for retiredmichael 12. retiredmichael Lv 1 76 pts. 9,639
  3. Avatar for nicobul 13. nicobul Lv 1 74 pts. 9,636
  4. Avatar for Galaxie 14. Galaxie Lv 1 72 pts. 9,636
  5. Avatar for Deleted player 15. Deleted player pts. 9,635
  6. Avatar for SKSbell 16. SKSbell Lv 1 68 pts. 9,632
  7. Avatar for Aubade01 17. Aubade01 Lv 1 67 pts. 9,629
  8. Avatar for pauldunn 18. pauldunn Lv 1 65 pts. 9,620
  9. Avatar for Blipperman 19. Blipperman Lv 1 63 pts. 9,617
  10. Avatar for fiendish_ghoul 20. fiendish_ghoul Lv 1 62 pts. 9,616

Comments