1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Summary

• Created: February 24, 2017
• Expires: March 03, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

• 1. Anthropic Dreams 100 pts. 9,691
• 2. Beta Folders 80 pts. 9,662
• 3. Contenders 63 pts. 9,660
• 4. Go Science 49 pts. 9,657
• 5. Void Crushers 37 pts. 9,656
• 6. HMT heritage 28 pts. 9,644
• 7. L'Alliance Francophone 21 pts. 9,636
• 8. Gargleblasters 15 pts. 9,617
• 9. Italiani Al Lavoro 11 pts. 9,449
• 10. :) 8 pts. 9,336

Top soloists

• 11. ZeroLeak7 78 pts. 9,641
• 12. retiredmichael 76 pts. 9,639
• 13. nicobul 74 pts. 9,636
• 14. Galaxie 72 pts. 9,636
• 15. Deleted player pts. 9,635
• 16. SKSbell 68 pts. 9,632
• 17. Aubade01 67 pts. 9,629
• 18. pauldunn 65 pts. 9,620
• 19. Blipperman 63 pts. 9,617
• 20. fiendish_ghoul 62 pts. 9,616