Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 8,672
  2. Avatar for xkcd 22. xkcd 1 pt. 8,664
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 8,436

  1. Avatar for diamonddays 31. diamonddays Lv 1 45 pts. 9,575
  2. Avatar for dcrwheeler 32. dcrwheeler Lv 1 44 pts. 9,570
  3. Avatar for Bletchley Park 33. Bletchley Park Lv 1 43 pts. 9,570
  4. Avatar for caglar 34. caglar Lv 1 41 pts. 9,569
  5. Avatar for phi16 35. phi16 Lv 1 40 pts. 9,566
  6. Avatar for lupussapien 36. lupussapien Lv 1 39 pts. 9,563
  7. Avatar for jobo0502 37. jobo0502 Lv 1 38 pts. 9,551
  8. Avatar for reefyrob 38. reefyrob Lv 1 37 pts. 9,547
  9. Avatar for pvc78 39. pvc78 Lv 1 36 pts. 9,538
  10. Avatar for joremen 40. joremen Lv 1 35 pts. 9,527

Comments