1345: Revisiting Puzzle 89: Cow Eye

Closed since about 9 years ago

Summary

• Created: February 24, 2017
• Expires: March 03, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups

• 1. Anthropic Dreams 100 pts. 9,691
• 2. Beta Folders 80 pts. 9,662
• 3. Contenders 63 pts. 9,660
• 4. Go Science 49 pts. 9,657
• 5. Void Crushers 37 pts. 9,656
• 6. HMT heritage 28 pts. 9,644
• 7. L'Alliance Francophone 21 pts. 9,636
• 8. Gargleblasters 15 pts. 9,617
• 9. Italiani Al Lavoro 11 pts. 9,449
• 10. :) 8 pts. 9,336

Top soloists

• 31. diamonddays 45 pts. 9,575
• 32. dcrwheeler 44 pts. 9,570
• 33. Bletchley Park 43 pts. 9,570
• 34. caglar 41 pts. 9,569
• 35. phi16 40 pts. 9,566
• 36. lupussapien 39 pts. 9,563
• 37. jobo0502 38 pts. 9,551
• 38. reefyrob 37 pts. 9,547
• 39. pvc78 36 pts. 9,538
• 40. joremen 35 pts. 9,527