Placeholder image of a protein
Icon representing a puzzle

1345: Revisiting Puzzle 89: Cow Eye

Closed since over 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 24, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein found at high concentrations of the lens of the eye; historically, this protein was purified from the eyes of B. taurus for research. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TFRMRIYERDDFRGQMSEITDDCPSLQDRFHLTEVHSLNVLEGSWVLYEMPSYRGRQYLLRPGEYRRYLDWGAMNAKVGSLRRVMDFY

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,691
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 9,662
  3. Avatar for Contenders 3. Contenders 63 pts. 9,660
  4. Avatar for Go Science 4. Go Science 49 pts. 9,657
  5. Avatar for Void Crushers 5. Void Crushers 37 pts. 9,656
  6. Avatar for HMT heritage 6. HMT heritage 28 pts. 9,644
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 9,636
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,617
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 9,449
  10. Avatar for :) 10. :) 8 pts. 9,336

  1. Avatar for WBarme1234 61. WBarme1234 Lv 1 18 pts. 9,445
  2. Avatar for MicElephant 62. MicElephant Lv 1 17 pts. 9,430
  3. Avatar for JayD7217 63. JayD7217 Lv 1 16 pts. 9,419
  4. Avatar for hansvandenhof 64. hansvandenhof Lv 1 16 pts. 9,414
  5. Avatar for deLaCeiba 65. deLaCeiba Lv 1 15 pts. 9,405
  6. Avatar for isaksson 66. isaksson Lv 1 15 pts. 9,404
  7. Avatar for alcor29 67. alcor29 Lv 1 14 pts. 9,395
  8. Avatar for actiasluna 68. actiasluna Lv 1 14 pts. 9,392
  9. Avatar for stomjoh 69. stomjoh Lv 1 13 pts. 9,389
  10. Avatar for katling 70. katling Lv 1 13 pts. 9,386

Comments