Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for genevadHCC2017 141. genevadHCC2017 Lv 1 1 pt. 10,953
  2. Avatar for gu14013 142. gu14013 Lv 1 1 pt. 10,685
  3. Avatar for Fatcat560 143. Fatcat560 Lv 1 1 pt. 10,520
  4. Avatar for demeter900 144. demeter900 Lv 1 1 pt. 10,494
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 10,290
  6. Avatar for MarioTime321 146. MarioTime321 Lv 1 1 pt. 10,211
  7. Avatar for Nick_Flamel 147. Nick_Flamel Lv 1 1 pt. 10,181
  8. Avatar for rob147147 148. rob147147 Lv 1 1 pt. 10,090
  9. Avatar for JWPBilly1 149. JWPBilly1 Lv 1 1 pt. 9,975
  10. Avatar for Zenoth42 150. Zenoth42 Lv 1 1 pt. 9,954

Comments