Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 12,881
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 12,880
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 12,880
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,776
  5. Avatar for Contenders 5. Contenders 37 pts. 12,738
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 12,726
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 12,683
  8. Avatar for xkcd 8. xkcd 15 pts. 12,601
  9. Avatar for Deleted group 9. Deleted group pts. 12,458
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 12,438
  1. Avatar for genevadHCC2017 141. genevadHCC2017 Lv 1 1 pt. 10,953
  2. Avatar for gu14013 142. gu14013 Lv 1 1 pt. 10,685
  3. Avatar for Fatcat560 143. Fatcat560 Lv 1 1 pt. 10,520
  4. Avatar for demeter900 144. demeter900 Lv 1 1 pt. 10,494
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 10,290
  6. Avatar for MarioTime321 146. MarioTime321 Lv 1 1 pt. 10,211
  7. Avatar for Nick_Flamel 147. Nick_Flamel Lv 1 1 pt. 10,181
  8. Avatar for rob147147 148. rob147147 Lv 1 1 pt. 10,090
  9. Avatar for JWPBilly1 149. JWPBilly1 Lv 1 1 pt. 9,975
  10. Avatar for Zenoth42 150. Zenoth42 Lv 1 1 pt. 9,954

Comments