Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BMB401_SP17 21. BMB401_SP17 1 pt. 8,334
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 0
  3. Avatar for HMT heritage 23. HMT heritage 1 pt. 0
  1. Avatar for pmdpmd 31. pmdpmd Lv 1 44 pts. 12,647
  2. Avatar for Bruno Kestemont 32. Bruno Kestemont Lv 1 42 pts. 12,641
  3. Avatar for mimi 33. mimi Lv 1 41 pts. 12,623
  4. Avatar for diamonddays 34. diamonddays Lv 1 40 pts. 12,623
  5. Avatar for Mike Cassidy 35. Mike Cassidy Lv 1 39 pts. 12,622
  6. Avatar for TastyMunchies 36. TastyMunchies Lv 1 37 pts. 12,613
  7. Avatar for fishercat 37. fishercat Lv 1 36 pts. 12,607
  8. Avatar for fryguy 38. fryguy Lv 1 35 pts. 12,601
  9. Avatar for Threeoak 39. Threeoak Lv 1 34 pts. 12,591
  10. Avatar for dcrwheeler 40. dcrwheeler Lv 1 33 pts. 12,571

Comments