Placeholder image of a protein
Icon representing a puzzle

1347: Unsolved De-novo Freestyle 101: Exposed Hydrophobics

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
February 27, 2017
Expires
Max points
100
Description

This is a followup to Puzzle 1344. The score function for this puzzle has been adjusted to allow buried polar residues and exposed hydrophobics. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets! Players will be able to load in manual saves from Puzzle 1344 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups


  1. Avatar for Go Science 100 pts. 12,881
  2. Avatar for Beta Folders 2. Beta Folders 80 pts. 12,880
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 63 pts. 12,880
  4. Avatar for Gargleblasters 4. Gargleblasters 49 pts. 12,776
  5. Avatar for Contenders 5. Contenders 37 pts. 12,738
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 12,726
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 21 pts. 12,683
  8. Avatar for xkcd 8. xkcd 15 pts. 12,601
  9. Avatar for Deleted group 9. Deleted group pts. 12,458
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 12,438

  1. Avatar for bergie72 161. bergie72 Lv 1 1 pt. 9,216
  2. Avatar for JoJack 162. JoJack Lv 1 1 pt. 9,213
  3. Avatar for 01010011111 163. 01010011111 Lv 1 1 pt. 8,956
  4. Avatar for lanarchiste1 164. lanarchiste1 Lv 1 1 pt. 8,882
  5. Avatar for g14023 165. g14023 Lv 1 1 pt. 8,718
  6. Avatar for cab20 166. cab20 Lv 1 1 pt. 8,683
  7. Avatar for oliverseattle 167. oliverseattle Lv 1 1 pt. 8,610
  8. Avatar for Ciccillo 168. Ciccillo Lv 1 1 pt. 8,564
  9. Avatar for Snake bite 169. Snake bite Lv 1 1 pt. 8,545
  10. Avatar for gu14001 170. gu14001 Lv 1 1 pt. 8,408

Comments