Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for BIO257C 21. BIO257C 1 pt. 8,324
  1. Avatar for johnmitch 51. johnmitch Lv 1 19 pts. 15,329
  2. Avatar for hpaege 52. hpaege Lv 1 18 pts. 15,277
  3. Avatar for Vredeman 53. Vredeman Lv 1 18 pts. 15,265
  4. Avatar for NinjaGreg 54. NinjaGreg Lv 1 17 pts. 15,253
  5. Avatar for Crossed Sticks 55. Crossed Sticks Lv 1 16 pts. 15,246
  6. Avatar for smilingone 56. smilingone Lv 1 16 pts. 15,245
  7. Avatar for Fat Tony 57. Fat Tony Lv 1 15 pts. 15,215
  8. Avatar for ZeroLeak7 58. ZeroLeak7 Lv 1 14 pts. 15,208
  9. Avatar for smholst 59. smholst Lv 1 14 pts. 15,206
  10. Avatar for hansvandenhof 60. hansvandenhof Lv 1 13 pts. 15,165

Comments