1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Summary

• Created: March 06, 2017
• Expires: March 13, 2017 at 23:00 UTC
• Max points: 100

Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:

MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

• 1. Anthropic Dreams 100 pts. 17,650
• 2. Go Science 78 pts. 17,627
• 3. Beta Folders 60 pts. 17,344
• 4. Void Crushers 45 pts. 16,932
• 5. Gargleblasters 33 pts. 16,653
• 6. Deleted group pts. 16,499
• 7. Contenders 17 pts. 16,180
• 8. L'Alliance Francophone 12 pts. 15,894
• 9. Italiani Al Lavoro 8 pts. 15,447
• 10. xkcd 6 pts. 14,977

Top soloists

• 51. johnmitch 19 pts. 15,329
• 52. hpaege 18 pts. 15,277
• 53. Vredeman 18 pts. 15,265
• 54. NinjaGreg 17 pts. 15,253
• 55. Crossed Sticks 16 pts. 15,246
• 56. smilingone 16 pts. 15,245
• 57. Fat Tony 15 pts. 15,215
• 58. ZeroLeak7 14 pts. 15,208
• 59. smholst 14 pts. 15,206
• 60. hansvandenhof 13 pts. 15,165