Placeholder image of a protein
Icon representing a puzzle

1350: Unsolved De-novo Freestyle 101: Predicted Contacts

Closed since about 9 years ago

Intermediate Overall Prediction Predicted Contacts

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a follow-up puzzle for Puzzle 1347, now with Predicted Contacts to help guide your folding! See the blog for information on using the contact map. You can see the predicted contacts for this protein by clicking the Contact Map button in the Main menu (Selection Interface) or in the Actions tab (Classic Interface). You will notice that different contacts are shown in different shades of green, with brighter green contacts indicating stronger predictions. Players will be able to load in manual saves from Puzzles 1344 and 1347 and use them as a starting point here.



Sequence:


MLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLTANLIGAFIIGIGFAWFSRMTNIDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWLFSASTAH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 17,650
  2. Avatar for Go Science 2. Go Science 78 pts. 17,627
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 17,344
  4. Avatar for Void Crushers 4. Void Crushers 45 pts. 16,932
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 16,653
  6. Avatar for Deleted group 6. Deleted group pts. 16,499
  7. Avatar for Contenders 7. Contenders 17 pts. 16,180
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 12 pts. 15,894
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 8 pts. 15,447
  10. Avatar for xkcd 10. xkcd 6 pts. 14,977
  1. Avatar for stomjoh 91. stomjoh Lv 1 3 pts. 14,710
  2. Avatar for gu14003 92. gu14003 Lv 1 3 pts. 14,703
  3. Avatar for freethought78 93. freethought78 Lv 1 3 pts. 14,699
  4. Avatar for randomlil 94. randomlil Lv 1 3 pts. 14,696
  5. Avatar for Sanechik 95. Sanechik Lv 1 3 pts. 14,677
  6. Avatar for Arne Heessels 96. Arne Heessels Lv 1 2 pts. 14,664
  7. Avatar for Imeturoran 97. Imeturoran Lv 1 2 pts. 14,656
  8. Avatar for dbuske 98. dbuske Lv 1 2 pts. 14,656
  9. Avatar for Jim Fraser 99. Jim Fraser Lv 1 2 pts. 14,613
  10. Avatar for senor pit 100. senor pit Lv 1 2 pts. 14,611

Comments