Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 7 pts. 8,526
  2. Avatar for xkcd 12. xkcd 5 pts. 8,442
  3. Avatar for Cannabis Crew 13. Cannabis Crew 4 pts. 8,369
  4. Avatar for Team Schleswig-Holstein 14. Team Schleswig-Holstein 3 pts. 8,312
  5. Avatar for Deleted group 15. Deleted group pts. 8,285
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 8,261
  7. Avatar for freefolder 17. freefolder 1 pt. 8,225
  8. Avatar for :) 18. :) 1 pt. 8,057
  9. Avatar for Deleted group 19. Deleted group pts. 7,825
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,807
  1. Avatar for diamonddays 51. diamonddays Lv 1 23 pts. 9,165
  2. Avatar for altejoh 52. altejoh Lv 1 22 pts. 9,164
  3. Avatar for Bushman 53. Bushman Lv 1 22 pts. 9,162
  4. Avatar for jermainiac 54. jermainiac Lv 1 21 pts. 9,160
  5. Avatar for Mike Cassidy 55. Mike Cassidy Lv 1 20 pts. 9,159
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 19 pts. 9,156
  7. Avatar for guineapig 57. guineapig Lv 1 19 pts. 9,154
  8. Avatar for smholst 58. smholst Lv 1 18 pts. 9,153
  9. Avatar for Crossed Sticks 59. Crossed Sticks Lv 1 17 pts. 9,147
  10. Avatar for pfirth 60. pfirth Lv 1 17 pts. 9,126

Comments