Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958
  1. Avatar for diamonddays 51. diamonddays Lv 1 23 pts. 9,165
  2. Avatar for altejoh 52. altejoh Lv 1 22 pts. 9,164
  3. Avatar for Bushman 53. Bushman Lv 1 22 pts. 9,162
  4. Avatar for jermainiac 54. jermainiac Lv 1 21 pts. 9,160
  5. Avatar for Mike Cassidy 55. Mike Cassidy Lv 1 20 pts. 9,159
  6. Avatar for WBarme1234 56. WBarme1234 Lv 1 19 pts. 9,156
  7. Avatar for guineapig 57. guineapig Lv 1 19 pts. 9,154
  8. Avatar for smholst 58. smholst Lv 1 18 pts. 9,153
  9. Avatar for Crossed Sticks 59. Crossed Sticks Lv 1 17 pts. 9,147
  10. Avatar for pfirth 60. pfirth Lv 1 17 pts. 9,126

Comments