Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for prrrki 131. prrrki Lv 1 1 pt. 8,285
  2. Avatar for severin333 132. severin333 Lv 1 1 pt. 8,284
  3. Avatar for senor pit 133. senor pit Lv 1 1 pt. 8,277
  4. Avatar for doctaven 134. doctaven Lv 1 1 pt. 8,261
  5. Avatar for Randolph_M_Snyder 135. Randolph_M_Snyder Lv 1 1 pt. 8,255
  6. Avatar for rakei 136. rakei Lv 1 1 pt. 8,233
  7. Avatar for Alistair69 137. Alistair69 Lv 1 1 pt. 8,233
  8. Avatar for navn 138. navn Lv 1 1 pt. 8,229
  9. Avatar for Pibeagles 139. Pibeagles Lv 1 1 pt. 8,227
  10. Avatar for Imeturoran 140. Imeturoran Lv 1 1 pt. 8,225

Comments