Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958
  1. Avatar for prrrki 131. prrrki Lv 1 1 pt. 8,285
  2. Avatar for severin333 132. severin333 Lv 1 1 pt. 8,284
  3. Avatar for senor pit 133. senor pit Lv 1 1 pt. 8,277
  4. Avatar for doctaven 134. doctaven Lv 1 1 pt. 8,261
  5. Avatar for Randolph_M_Snyder 135. Randolph_M_Snyder Lv 1 1 pt. 8,255
  6. Avatar for rakei 136. rakei Lv 1 1 pt. 8,233
  7. Avatar for Alistair69 137. Alistair69 Lv 1 1 pt. 8,233
  8. Avatar for navn 138. navn Lv 1 1 pt. 8,229
  9. Avatar for Pibeagles 139. Pibeagles Lv 1 1 pt. 8,227
  10. Avatar for Imeturoran 140. Imeturoran Lv 1 1 pt. 8,225

Comments