Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups


  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0

  1. Avatar for emdee314 161. emdee314 Lv 1 1 pt. 7,977
  2. Avatar for Ashrai 162. Ashrai Lv 1 1 pt. 7,941
  3. Avatar for RT-Kaen 163. RT-Kaen Lv 1 1 pt. 7,927
  4. Avatar for andrewxc 164. andrewxc Lv 1 1 pt. 7,917
  5. Avatar for Dantoto 165. Dantoto Lv 1 1 pt. 7,886
  6. Avatar for parsnip 166. parsnip Lv 1 1 pt. 7,880
  7. Avatar for GenVeers 167. GenVeers Lv 1 1 pt. 7,840
  8. Avatar for Psych0Active 168. Psych0Active Lv 1 1 pt. 7,825
  9. Avatar for mikejcroc 169. mikejcroc Lv 1 1 pt. 7,810
  10. Avatar for aspadistra 170. aspadistra Lv 1 1 pt. 7,807

Comments