Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958
  1. Avatar for emdee314 161. emdee314 Lv 1 1 pt. 7,977
  2. Avatar for Ashrai 162. Ashrai Lv 1 1 pt. 7,941
  3. Avatar for RT-Kaen 163. RT-Kaen Lv 1 1 pt. 7,927
  4. Avatar for andrewxc 164. andrewxc Lv 1 1 pt. 7,917
  5. Avatar for Dantoto 165. Dantoto Lv 1 1 pt. 7,886
  6. Avatar for parsnip 166. parsnip Lv 1 1 pt. 7,880
  7. Avatar for GenVeers 167. GenVeers Lv 1 1 pt. 7,840
  8. Avatar for Psych0Active 168. Psych0Active Lv 1 1 pt. 7,825
  9. Avatar for mikejcroc 169. mikejcroc Lv 1 1 pt. 7,810
  10. Avatar for aspadistra 170. aspadistra Lv 1 1 pt. 7,807

Comments