Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for WA HBio 2017 21. WA HBio 2017 1 pt. 7,800
  2. Avatar for SciOne2017 22. SciOne2017 1 pt. 7,753
  3. Avatar for BMB401_SP17 23. BMB401_SP17 1 pt. 7,638
  4. Avatar for Window Group 24. Window Group 1 pt. 6,899
  5. Avatar for Deleted group 25. Deleted group pts. 0
  1. Avatar for markm457 11. markm457 Lv 1 77 pts. 9,320
  2. Avatar for Deleted player 12. Deleted player pts. 9,319
  3. Avatar for actiasluna 13. actiasluna Lv 1 73 pts. 9,317
  4. Avatar for pauldunn 14. pauldunn Lv 1 71 pts. 9,310
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 69 pts. 9,308
  6. Avatar for gitwut 16. gitwut Lv 1 67 pts. 9,302
  7. Avatar for caglar 17. caglar Lv 1 66 pts. 9,300
  8. Avatar for Timo van der Laan 18. Timo van der Laan Lv 1 64 pts. 9,299
  9. Avatar for pmdpmd 19. pmdpmd Lv 1 62 pts. 9,284
  10. Avatar for bertro 20. bertro Lv 1 60 pts. 9,278

Comments