1351: Revisiting Puzzle 90: Heliomicin

Closed since almost 9 years ago

Summary

• Created: March 06, 2017
• Expires: March 16, 2017 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

• 1. Beta Folders 100 pts. 9,420
• 2. Go Science 81 pts. 9,383
• 3. Contenders 65 pts. 9,329
• 4. L'Alliance Francophone 52 pts. 9,326
• 5. Anthropic Dreams 41 pts. 9,326
• 6. Gargleblasters 32 pts. 9,317
• 7. Void Crushers 24 pts. 9,302
• 8. Italiani Al Lavoro 18 pts. 9,233
• 9. HMT heritage 14 pts. 8,976
• 10. Natural Abilities 10 pts. 8,958

Top soloists

• 11. markm457 77 pts. 9,320
• 12. Deleted player pts. 9,319
• 13. actiasluna 73 pts. 9,317
• 14. pauldunn 71 pts. 9,310
• 15. dcrwheeler 69 pts. 9,308
• 16. gitwut 67 pts. 9,302
• 17. caglar 66 pts. 9,300
• 18. Timo van der Laan 64 pts. 9,299
• 19. pmdpmd 62 pts. 9,284
• 20. bertro 60 pts. 9,278