Placeholder image of a protein
Icon representing a puzzle

1351: Revisiting Puzzle 90: Heliomicin

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 06, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,420
  2. Avatar for Go Science 2. Go Science 81 pts. 9,383
  3. Avatar for Contenders 3. Contenders 65 pts. 9,329
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 52 pts. 9,326
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 41 pts. 9,326
  6. Avatar for Gargleblasters 6. Gargleblasters 32 pts. 9,317
  7. Avatar for Void Crushers 7. Void Crushers 24 pts. 9,302
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 18 pts. 9,233
  9. Avatar for HMT heritage 9. HMT heritage 14 pts. 8,976
  10. Avatar for Natural Abilities 10. Natural Abilities 10 pts. 8,958
  1. Avatar for jamiexq 71. jamiexq Lv 1 11 pts. 8,974
  2. Avatar for dssb 72. dssb Lv 1 11 pts. 8,973
  3. Avatar for Simek 73. Simek Lv 1 10 pts. 8,969
  4. Avatar for Mr_Jolty 74. Mr_Jolty Lv 1 10 pts. 8,958
  5. Avatar for Merf 75. Merf Lv 1 10 pts. 8,945
  6. Avatar for Fog Darts 76. Fog Darts Lv 1 9 pts. 8,944
  7. Avatar for ViJay7019 77. ViJay7019 Lv 1 9 pts. 8,942
  8. Avatar for johngran 78. johngran Lv 1 8 pts. 8,933
  9. Avatar for JayD7217 79. JayD7217 Lv 1 8 pts. 8,898
  10. Avatar for ManVsYard 80. ManVsYard Lv 1 8 pts. 8,890

Comments