Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary


Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups


  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441

  1. Avatar for ViJay7019 91. ViJay7019 Lv 1 4 pts. 8,552
  2. Avatar for ManVsYard 92. ManVsYard Lv 1 4 pts. 8,549
  3. Avatar for smholst 93. smholst Lv 1 3 pts. 8,545
  4. Avatar for cashome 94. cashome Lv 1 3 pts. 8,529
  5. Avatar for Mr_Jolty 95. Mr_Jolty Lv 1 3 pts. 8,528
  6. Avatar for benrh 96. benrh Lv 1 3 pts. 8,525
  7. Avatar for SKSbell 97. SKSbell Lv 1 3 pts. 8,518
  8. Avatar for Savas 98. Savas Lv 1 3 pts. 8,516
  9. Avatar for dbuske 99. dbuske Lv 1 3 pts. 8,515
  10. Avatar for Psych0Active 100. Psych0Active Lv 1 2 pts. 8,507

Comments