Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441
  1. Avatar for flapje 171. flapje Lv 1 1 pt. 0
  2. Avatar for BIO257C-ivillagran 172. BIO257C-ivillagran Lv 1 1 pt. 0
  3. Avatar for Hollinas 173. Hollinas Lv 1 1 pt. 0
  4. Avatar for louise99 174. louise99 Lv 1 1 pt. 0
  5. Avatar for BIO257C-fagarcia 175. BIO257C-fagarcia Lv 1 1 pt. 0
  6. Avatar for gaving1 176. gaving1 Lv 1 1 pt. 0
  7. Avatar for BIO257C-blozano 177. BIO257C-blozano Lv 1 1 pt. 0
  8. Avatar for BIO257C - cdiaz 178. BIO257C - cdiaz Lv 1 1 pt. 0
  9. Avatar for 42SciOne 179. 42SciOne Lv 1 1 pt. 0
  10. Avatar for andrewxc 180. andrewxc Lv 1 1 pt. 0

Comments