Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441
  1. Avatar for Wilm 11. Wilm Lv 1 76 pts. 9,159
  2. Avatar for LociOiling 12. LociOiling Lv 1 74 pts. 9,156
  3. Avatar for bertro 13. bertro Lv 1 72 pts. 9,130
  4. Avatar for Skippysk8s 14. Skippysk8s Lv 1 70 pts. 9,128
  5. Avatar for kabubi 15. kabubi Lv 1 68 pts. 9,116
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 66 pts. 9,115
  7. Avatar for reefyrob 17. reefyrob Lv 1 64 pts. 9,110
  8. Avatar for hpaege 18. hpaege Lv 1 62 pts. 9,106
  9. Avatar for eusair 19. eusair Lv 1 60 pts. 9,101
  10. Avatar for spvincent 20. spvincent Lv 1 58 pts. 9,074

Comments