Placeholder image of a protein
Icon representing a puzzle

1353: Unsolved De-novo Freestyle 102

Closed since about 9 years ago

Intermediate Overall Prediction

Summary

Created
March 14, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


RREDEIRRIIERVHREDSSMELRIEHRNGQLHIEFRKNGDRQEYRTEIKHESEIRKRIEEYRKKS

Top groups

  1. Avatar for GUGITBIOTECH 11. GUGITBIOTECH 3 pts. 8,561
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 8,528
  3. Avatar for Eὕρηκα! Heureka! 13. Eὕρηκα! Heureka! 1 pt. 8,516
  4. Avatar for D001x Med Chem MOOC 14. D001x Med Chem MOOC 1 pt. 8,495
  5. Avatar for SciOne2017 15. SciOne2017 1 pt. 8,386
  6. Avatar for :) 16. :) 1 pt. 8,352
  7. Avatar for BIO257C 17. BIO257C 1 pt. 7,914
  8. Avatar for LEC Metabolites 18. LEC Metabolites 1 pt. 7,740
  9. Avatar for Deleted group 19. Deleted group pts. 6,829
  10. Avatar for SFASU_BIOL4356/5356 20. SFASU_BIOL4356/5356 1 pt. 6,441
  1. Avatar for actiasluna 21. actiasluna Lv 1 56 pts. 9,073
  2. Avatar for pauldunn 22. pauldunn Lv 1 55 pts. 9,065
  3. Avatar for Keresto 23. Keresto Lv 1 53 pts. 9,052
  4. Avatar for Vredeman 24. Vredeman Lv 1 51 pts. 9,030
  5. Avatar for mimi 25. mimi Lv 1 50 pts. 9,029
  6. Avatar for Bruno Kestemont 26. Bruno Kestemont Lv 1 48 pts. 9,021
  7. Avatar for johnmitch 27. johnmitch Lv 1 47 pts. 9,017
  8. Avatar for pmdpmd 28. pmdpmd Lv 1 45 pts. 9,005
  9. Avatar for TastyMunchies 29. TastyMunchies Lv 1 44 pts. 8,998
  10. Avatar for ZeroLeak7 30. ZeroLeak7 Lv 1 42 pts. 8,993

Comments